SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EE18 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D5EE18
Domain Number - Region: 93-186
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0796
Family ABC transporter ATPase domain-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EE18
Sequence length 394
Comment (tr|D5EE18|D5EE18_AMICL) Uncharacterized protein with the myosin-like protein domain {ECO:0000313|EMBL:ADE56800.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0665 OC=Aminobacterium.
Sequence
MQAQIWSDMNWKLIITLLMVSAILAYFGDRVGMRIGKKRISLFGLRPRHTSQIITAFTGV
VISVGILLTMSVVSENVRTALFSMKFLQSQIINLTAELQESRDEAQLASIRLMESQSKLE
EQEKKLREIQGQLAKVQPELEKAQKELTGLKGEKDSLKKEKVKLDQEVSRLRQEADHLRE
GLVQVRSGRIAVFAGELLGQQVVPPGSSQKEVEAIFESLRRRAELMVSLRTGISADTIIL
DVDLKVERTKIQECVNALERKFIRILAGSNALLGEDVRVRYEVHDSKLVYQKGKVVASRL
WQPDAADAADAESFLHDLLAELNQRAVTEGIMPDPASGKIGAMDATHFFETVEILQETRQ
EVEVVVVVAEDIYTEGPVKIKFEVVPLGDRLQGE
Download sequence
Identical sequences D5EE18
WP_013048066.1.58668 gi|294101666|ref|YP_003553524.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]