SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EE33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EE33
Domain Number 1 Region: 2-196
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.58e-41
Family Class I glutamine amidotransferases (GAT) 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EE33
Sequence length 204
Comment (tr|D5EE33|D5EE33_AMICL) ImGP synthase subunit HisH {ECO:0000256|HAMAP-Rule:MF_00278} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0680 OC=Aminobacterium.
Sequence
MIGIIDYGAGNVGNVQRALSFHNERSTILRCPDQINNSIDLLILPGVGAFAPAMSALEKE
GWPFFLSQWVEKGHPLLGICLGLHLLCEGGEEGGYRKGLGFLEGVIRHLGTQKYPHMGWN
SLEWIRSAQGLEKSCHSNDYFYFVHSYGLPQTNDTVAIARVEEREVSAICLRDSVAAFQF
HPERSGSAGLSILKGAIDLLRRHS
Download sequence
Identical sequences D5EE33
gi|294101681|ref|YP_003553539.1| WP_013048081.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]