SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EE83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EE83
Domain Number 1 Region: 6-255
Classification Level Classification E-value
Superfamily PHP domain-like 6.28e-36
Family PHP domain 0.01
Further Details:      
 
Weak hits

Sequence:  D5EE83
Domain Number - Region: 966-1044
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0142
Family Single strand DNA-binding domain, SSB 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EE83
Sequence length 1144
Comment (tr|D5EE83|D5EE83_AMICL) DNA-directed DNA polymerase {ECO:0000256|SAAS:SAAS00367720} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0732 OC=Aminobacterium.
Sequence
MTTRPFVHLHVHSEYSLLDGAIRCGELAERVASWGMPAVALTDHGAMYGAIEFYDRCLAA
GIKPIVGCEVYVDPEGHTSREKKGRNFHLLLLAENQQGYNNLIKLVSIANTDGFYYRPRI
DYDLLTQYSQGIIASSACLAGEIPSLILQGKENDALAKAHMYRDIMGEDNFFLEIMYNAI
PEQAVVNRSLVQMARKNNFNLVATNDAHYLNKEDYDWHEILLCVQTGATINDPDRMSFST
NDFYLRSPEEMDSLFGAELPDALDNTLAIAERCSLKFDLGTRDYKLPSFDLPEGETLESN
LEKEAMAGLKQRLHKDNVPEEYKKRLDYELKVIKKMGFAGYFLIVASIIRAAKDRDIPIG
PGRGSAAGSLVAYSLRITELDPLKYNLLFERFLNPERVSMPDIDTDVSDKGREELLQYIA
EKYGVDRVAQIITFDRMKSKAAIRDVGRALGMPYSDVDVVAKLIPDGARSIPEALDQSED
LRNLTHKDLAVSRLLDSASKIEGLARHCSQHAAGVVITPMPITDLVPVRRIGENQIVTQF
PMEPLEKLGLVKMDFLGLKTLSVLEEAINNIKLNGKTPPDLNKIPLNDNLTYEMLQRGNT
LGVFQLESTGMRQLLRKIKPDCFEDLIAVLALYRPGPLGSGMVDQYIERKHGRAVVEYLH
PELSEVLKETYGVILYQEQVMQSAACLAGYSLGEADLLRRAMGKKKVEVMQQQRKMFADG
CAQHNVPARKAEEIFDIIQEFAGYGFNKSHSAAYALISYQTAYLKANFQPEFMAAYLTSQ
IGSKKDVMARYIREVRNSGIEVLPPDVNSSMESFAAVDEVVRFGLGAVAKAGHGAVEAII
AARECGGEFSSLWNFLCRVDLRVVNKSVIENLIKAGAFDGLNSNRRQLISALPDFVALAQ
RKGEEKNQCSLLSLLDEDSESGDLEPELPDIEDYAIYERLDMEKEVVGLYISGHPFTQHE
TLVSRYSTCSISNLKYWRSRNLFPQIGGMILSVHEKYTKRGDPMGILEVEDAESKLEVIC
FPKIWSSIKDQIEPGEICIIRGTLDERGSGNIIAKEIVSFQAIQGKMPPFVKIVLDGTLL
QPNSMKNFIRSLKDFPGRSQVLLEIRNGVGSVVILLSGIKVDGPTIKSKGLAPALPEEAY
EVFC
Download sequence
Identical sequences D5EE83
gi|294101731|ref|YP_003553589.1| WP_013048131.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]