SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EEL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EEL3
Domain Number 1 Region: 22-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.89e-51
Family Extended AAA-ATPase domain 0.000000395
Further Details:      
 
Domain Number 2 Region: 258-332
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.38e-24
Family Helicase DNA-binding domain 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EEL3
Sequence length 352
Comment (tr|D5EEL3|D5EEL3_AMICL) Holliday junction ATP-dependent DNA helicase RuvB {ECO:0000256|HAMAP-Rule:MF_00016} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0864 OC=Aminobacterium.
Sequence
MTEERTNFFDLQKKDFEEELTLRPSSLQDFVGQQKLKDKLSIYVQAARQRKEALDHILFY
GPPGLGKTTLAGIIAHEMGGQLRVTTGPALEKAGDIAAILSNLEPFDVLFIDEIHRLPAN
VEEILYPSMEDFSLHIIVGKGPLANNICLTLPPFTLVGATTRLGLLTSPLRARFGIVEQL
ALYNVDETSEIVQRGAKVLGIEIEEEAAYEIARRSRGTPRVAIRLLKRVRDVAEVRQSPS
INTAVASVALNMLGLDTLGLDDGDRRILQVIVELFDGGPVGLSTIAAALNEEGQTIEDIY
EPYLIQKGLIERTPRGRKATRNGYLYLGKNPPETLNDQLELYQEEESGICKE
Download sequence
Identical sequences D5EEL3
gi|294101861|ref|YP_003553719.1| WP_013048261.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]