SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EEP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EEP4
Domain Number 1 Region: 20-194
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.52e-35
Family G proteins 0.0000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EEP4
Sequence length 197
Comment (tr|D5EEP4|D5EEP4_AMICL) Probable GTP-binding protein EngB {ECO:0000256|HAMAP-Rule:MF_00321, ECO:0000256|SAAS:SAAS00023450} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0895 OC=Aminobacterium.
Sequence
MAQRWKAQLAMTAFKEDQFPPQTLPEVAFVGRSNVGKSMLLNALMERKLAHVGSTPGKTR
SVNFYKIEAEVDFFLVDLPGYGYAARGFKEKEKWAKLIEQYITQRETLQLLVHLVDFRHG
LLKNDQELQEWISQIGIPSLVVFTKADKISKGRHKGMLHSYIRKGLKSIEVPFIVSAQDK
SGVGEFRQFLTQYLNRG
Download sequence
Identical sequences D5EEP4
WP_013048289.1.58668 gi|294101892|ref|YP_003553750.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]