SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EER1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EER1
Domain Number 1 Region: 19-140
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 0.000000000392
Family Serine dehydratase beta chain-like 0.017
Further Details:      
 
Weak hits

Sequence:  D5EER1
Domain Number - Region: 343-475
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.000889
Family 2-methylcitrate dehydratase PrpD 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EER1
Sequence length 516
Comment (tr|D5EER1|D5EER1_AMICL) L-serine dehydratase, iron-sulfur-dependent, alpha subunit {ECO:0000313|EMBL:ADE57043.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0913 OC=Aminobacterium.
Sequence
MKHSILNDVLGPVMRGPSSSHTAASYRIAAIARSLLKSSLKEVIFTFDREGSYGEVFRQQ
GSDLAFAAGALGWDITDSRFEDVLGIAQRKGKLILFQIDDISDSNHPNEVLVSMAGTGGD
SVELLARSVGGGAIVITKIDGWPVWITGDSHDLFIVTNSEGKDSLLLKIEEHNRNERSVT
IHERDGQFLIHIAYLRRPVKEILKNLESMTGVLSLKISCPVVYACPGEPLFTSAKELLKI
VGEKGKSLADASLSYESQMLKLPEEEIWAEMSSRLEIMEEAARAGIEDHPFEMKLIRPSA
GKIYKAEIEGKLPIGGLHSQAMARALGVMHVNASKGIICAAPTAGSSGVIPGVILTLAER
FRLSREEKIRALFTASAIGLIVAIRATFSAEVAGCQAEIGVAGAMASAAVVEVAGGSPEQ
ALDAASIFLQNSLGSICDPVQGFVEIPCHTRNGVAASSAFVCADIVMGGYFNPLPFDEVV
DAMYSVGKLLPRELRCTAKGGLSICPSGCALPLLSK
Download sequence
Identical sequences D5EER1
gi|294101909|ref|YP_003553767.1| WP_013048306.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]