SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EER4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D5EER4
Domain Number - Region: 279-383
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.00589
Family 2-methylcitrate dehydratase PrpD 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EER4
Sequence length 432
Comment (tr|D5EER4|D5EER4_AMICL) UPF0597 protein Amico_0917 {ECO:0000256|HAMAP-Rule:MF_01845} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0917 OC=Aminobacterium.
Sequence
MTSKLLLEILKEHTFLTVGCTDPVAVGLSAAFAYKAIGGEIFSVDVIMDKNIYKDAISVG
IPGTMKTGLDLAVSLSVLFGNPENGLRLLKDVDKQCVVKAEKFLSNHKISFSLNEEVEGI
YIKSIVKTSKGIATALIRNSHDNIVEITVNQKITYSKRYSSAPKDSFNKLGCIANLTVED
IFKFIKEIDSKEIAFLNQGIQTNLKAAQIGEKKRVGLGVGKLYQEMIEKRYLPDDVSSRV
KQKVGAAADARMSGMNVPIYGCFGSGNHGITLFITMGMMAEHLKISKEETSRALSIALLI
IGVIKTRTGILTPHCGCSVAAGAGAASGIAYMLGGKEKEVENTVHLMLANLTGMLCDGAK
YGCALKMATSAGAAIECAYMAMLNAKVPGNNGIVGWNMKQTMDNLKIITEYGMKNIDKSV
LAILLKLPYFEN
Download sequence
Identical sequences D5EER4
WP_013048309.1.58668 gi|294101912|ref|YP_003553770.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]