SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EEW5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EEW5
Domain Number 1 Region: 149-325
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.62e-52
Family G proteins 0.0000577
Further Details:      
 
Domain Number 2 Region: 434-560
Classification Level Classification E-value
Superfamily Initiation factor IF2/eIF5b, domain 3 9.15e-37
Family Initiation factor IF2/eIF5b, domain 3 0.0045
Further Details:      
 
Domain Number 3 Region: 555-651
Classification Level Classification E-value
Superfamily Translation proteins 5.89e-33
Family Elongation factors 0.000036
Further Details:      
 
Domain Number 4 Region: 329-408
Classification Level Classification E-value
Superfamily Translation proteins 8.05e-23
Family Elongation factors 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EEW5
Sequence length 654
Comment (tr|D5EEW5|D5EEW5_AMICL) Translation initiation factor IF-2 {ECO:0000256|HAMAP-Rule:MF_00100, ECO:0000256|RuleBase:RU000644} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_0972 OC=Aminobacterium.
Sequence
MSKIRVYELAKMLEISNKDLLTMLEDLGIDAKTHMSSIDNDAAQLVEETIRKKEAKQPPK
TQKEETKVKEKQTIRVREAATVKEVAQVIDVPVAEAVKALLDLGIMAPAGAQVDETILIA
LGEAYGIDFEYEEPEEEKVATGRPVFHGKHMEPRPPIVTVMGHVDHGKTTLLDYIRQTNI
TAREAGGITQHIGASTVTYEGKNIVFLDTPGHEAFTAMRARGAQATDIAILVVAADDGLM
PQTKEAINHARAAGVPIVVAVNKIDKPAARPDRVRQQLSDVGLVPEEWGGDSIMVDVSAK
TGEGIPHLLEMVLLVAEMEELRADPTVTPEGIVIEANLDKGKGPVATVIVQQGTLRKGDI
ILLDTTWGKIRAMLDSRGRQFLKAGPSTPVEILGLTSVPQPGEHFVRVDNEKSARDEISK
REQEKRESENVTAKRLTLEELYSQLKEGEIPQLNLLVKTDVQGTNEALCAALEKMGTNEV
GINIIHRGVGRIAESDIMLATASNAVVIGFNVRPDKNAERIAEVEGVQIRLYNVIYDVVD
DVKAALEGMLTPTIKEEELGQAEIRQVFKVPKAGKIAGCYVTEGMIKRNCRVRIIRDGVV
IWTGSLANLRRFKDEAKEVKAGYECGMSFTNYQDFREGDVVEAYELVEEKRYLE
Download sequence
Identical sequences D5EEW5
WP_013048360.1.58668 gi|294101963|ref|YP_003553821.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]