SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EF44 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EF44
Domain Number 1 Region: 43-161
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000025
Family Extended AAA-ATPase domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EF44
Sequence length 256
Comment (tr|D5EF44|D5EF44_AMICL) DNA polymerase III gamma/tau subunits-like protein {ECO:0000313|EMBL:ADE57176.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1052 OC=Aminobacterium.
Sequence
MNEKETCFVTSSLMWSELKKALEGNRFPQSLALSAPKQYHEKIAIDIARLLLCEKKNACG
QCLSCCSWHEKTHPDLVLSGSLEKAPTISECREIAVELSLYPVVASCRLVVIQSADTLLL
PAANSMLKIVEEPPEHGVILFLLENDKFLPTLKSRCWNLALAHEERFEPEEIPSAERSWK
KWLESGETMTIEELEKQLHCWETWAIEEGQASLAARVDRLRLICESRKLPQGMVLDLILL
SLKEGFAFEHVFDNLW
Download sequence
Identical sequences D5EF44
gi|294102042|ref|YP_003553900.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]