SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EF83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EF83
Domain Number 1 Region: 84-158
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.11e-24
Family ScpB/YpuH-like 0.0014
Further Details:      
 
Domain Number 2 Region: 5-76
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000313
Family ScpB/YpuH-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EF83
Sequence length 180
Comment (tr|D5EF83|D5EF83_AMICL) Segregation and condensation protein B {ECO:0000256|SAAS:SAAS00383129} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1091 OC=Aminobacterium.
Sequence
MLSSLAKHVEVLLFVAVTPVSEKELSMHLDESLEAVCSALGELSDHYAQDHGITLRKVAE
GWELCTDPEFAETVAIFRETALRQKVRLSRAAVESLAVIAYNQPVTRAEIEEIRGVRCER
VLETLLSHGLIRIAGRRRGTGSPLLYRTTETFLEHFGLESIAELPTLEEVEEYSVEESEH
Download sequence
Identical sequences D5EF83
gi|294102081|ref|YP_003553939.1| WP_013048478.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]