SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EFU7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EFU7
Domain Number 1 Region: 97-230
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 5.23e-23
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 7-78
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.66e-20
Family GntR-like transcriptional regulators 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EFU7
Sequence length 234
Comment (tr|D5EFU7|D5EFU7_AMICL) Regulatory protein GntR HTH {ECO:0000313|EMBL:ADE57429.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1310 OC=Aminobacterium.
Sequence
MGISFTKINRQSVTESIVEAFKQKILNGEISSGDKLPSERDLVESFGVSRASVREALRAL
RYMGVLEVHSGEGTFLTENISLLSDHFKISLLLKQCSVRELVEARKIIECETVSLATIRS
SKEEKEALKKLHKYAMTLVDDEQPFLKADFAFHEKIAEMSQNMVLVEMLNATRDLTLSEN
MYVIEREGQIKRALDFHSSILYYILSFDADNAQKAMLAHLEDIERSIRDLVSRH
Download sequence
Identical sequences D5EFU7
WP_013048692.1.58668 gi|294102295|ref|YP_003554153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]