SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EFW7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EFW7
Domain Number 1 Region: 24-80,140-443
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.12e-35
Family ABC transporter ATPase domain-like 0.084
Further Details:      
 
Weak hits

Sequence:  D5EFW7
Domain Number - Region: 638-675,729-771
Classification Level Classification E-value
Superfamily C-terminal domain of PLC-beta 0.00327
Family C-terminal domain of PLC-beta 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EFW7
Sequence length 795
Comment (tr|D5EFW7|D5EFW7_AMICL) Uncharacterized protein {ECO:0000313|EMBL:ADE57449.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1331 OC=Aminobacterium.
Sequence
MENFELMGKFYLGKEIEPQSGKVSDNLVLYDSKDLTTHGMIIGMTGSGKTGLGIALLEEA
LMDNIPVIAIDPKGDITNLLLSFPEQRSEDFLPWINIENATAEGFPPSEYAAREAEKWKK
GLAGWGIDGDRIKKMRESVSFSIYTPGSNSGIKVNVLGSFRCPSEKIINDHDLFLEKVQN
TTSTLLSLLNIESDPLSGREHLLISKIFEQSWRNGKDVDLPMIINGIQTPPFAQIGVMPT
DTFYPPSERFKLALALNQILASPAFNQWMTGVPLEIGSFLHSPEGKPRASIFTVSHLSDN
ERMFFISMVLNEIVGWMRTQTGTPSLRAILYIDEVFGYMPPVKEPPSKKPLITLLKQARA
FGIGVVLATQNPVDLDYKGLSNIGTWFIGRLQTQRDKDRVLEGLERLENASGYDRQFLDK
AITGLKKREFLLNNVHENSPSIFTSRWAMSYLRGPLTREQISSIMEERKEEPHVEGAKPA
MERTRGVKGYTSPVKPAISPDVNEFFVDLPVTSDSWAYKPFIVGSGDIYYSNPKLGIEER
IACLLGAEAPHNTLEPNWENALELDEGDLCREGNEQLKFLELPAAMANPSNYKKWEKAFQ
RWIRQNKPLVIFKNQSLKLASSPGEGRGDFEIRVEEALREKRDMEIEKLRKKYDSKMATL
QKQLMAAEQAIARESEQAKNRNIDTVISFGSAIASALLGRKSLTATSTYRMGSALSKAGR
LRKEKMDIARAEEKTQFIQEQLAALEASLNEEIEKLTESMEKYREATQEHLVRPQSTNIN
IKVFGLAWVPVEIEN
Download sequence
Identical sequences D5EFW7
WP_013048712.1.58668 gi|294102315|ref|YP_003554173.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]