SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EFX2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EFX2
Domain Number 1 Region: 344-400,638-812
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.81e-34
Family Tandem AAA-ATPase domain 0.0023
Further Details:      
 
Domain Number 2 Region: 251-465
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.32e-23
Family Tandem AAA-ATPase domain 0.016
Further Details:      
 
Domain Number 3 Region: 113-199
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.000000879
Family Nuclease 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EFX2
Sequence length 1065
Comment (tr|D5EFX2|D5EFX2_AMICL) Helicase domain protein {ECO:0000313|EMBL:ADE57454.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1337 OC=Aminobacterium.
Sequence
MSTDLSFITNEENQNLKERFKILIKSTDFFDCLVGYFYSSGFHAIYPSLEDTQKIRILIG
ISTNRETFNVMEEANKATQQLFDFSHAETKQEVENLVLAEMEESEDNRNVEEGVHKFIEW
IKTGKLEIRAYPSKKIHAKLYIMTFSEDDRDRGRVITGSSNFTQAGLVDNLEFNVELKNR
SDYEFAKNKFDKLWADAVDVSEKYVQTIQDKTWLTQNVTPYELYLKFLYEYFKDELSQTD
EVFVRYLPQEFKRLEYQEQAVLNAKKIVLEYGGVFISDVVGLGKTYISAMLAGQLDGRTL
VIAPPVLLEKTNPGSWPNVFSDFRVPADYESIGRLDNLIERGTEKYTNIIIDEAHRFRTE
TTITYEKLAEICRGKRVILVTATPYNNSPKDILSLLKLFQKGQKSTIPNLPNLESFFNSL
DKKLKQLDRKKDYDKYIETVKENAREIRNKVLKYLMVRRTRAEIEEYFSRDIKEQGLKFP
KVAKPVPLFYELNEKEDFIFNRTIEHIANQFKYARYMPMLYYKNELNQLERQSQRNMGRF
MKILLVKRLESSFFAFRNTGQRFLNSYNMFLKELDDGFIYVSKKYSNKIFELLESDDDEA
LQKLIDEGKAERYSSEDFKDELRTDLEHDRAILMEIKRLWEQIDRDPKLLKFKKELSTNA
TLQKNHLIIFTESKETANYLFEEINKEYPKKVLLFTGDSKEAVRDKVIANFDARARSKKG
DYRILISTEVLSEGVNLHRSNVVVNYDIPWNPTRMMQRVGRINRVDTPFDVIHTFNFFPT
TQSNDQIKLKEAAEGKINAFLTLLGGDAELLTEGEPIGSHELFDRLTSAKTLEGNDESEE
SELKYLRVIQDIREKNAELFERIKRLPKKARTSKQKFESAGSLITYFRLGKLQKFFMSKD
KDEAQELDFMTAAKLLESNPEEKRKHIPGEIYDLLDKNKNAFIVATTEEVTKPQRGKGKD
SAANILKILKATMSNTQKFTEDQEDYLRKVFTQLEEGGLPKQTTKNTLQALQSLRKELVN
PLKVLAVLQANVPAGLLESHYAEQNPAASGKREVILSLYLAGEKE
Download sequence
Identical sequences D5EFX2
WP_013048717.1.58668 gi|294102320|ref|YP_003554178.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]