SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EG11 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EG11
Domain Number 1 Region: 165-503
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.13e-112
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000818
Further Details:      
 
Domain Number 2 Region: 16-158
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.52e-35
Family Anticodon-binding domain 0.00037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EG11
Sequence length 506
Comment (tr|D5EG11|D5EG11_AMICL) Lysyl-tRNA synthetase {ECO:0000256|HAMAP-Rule:MF_00252} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1376 OC=Aminobacterium.
Sequence
MSANLEIKTEEIALPEEEIFRQRKEKLARLREEEGYDPFLIERWERSDLLNDVRQRFDHL
EIDEADEDAILSVAGRVMTLRKHGKAMFANLQDETDTMQLYFQLNAMGEEAYDFAKKWVD
NGDFVGVVGIPFRTRRGELTILVKESTLLSKVLRPLPEKWHGLKDTEVRYRQRYLDLMVN
TDVRDTFRKRSDIIASMRKTLIDHGTLEVETPILSFLAGGANARPFQTYHNALDANMYLR
IATELYLKRLVVGMFGRVFEIGKNFRNEGIDTMHNPEFTLMEVYWAYADYSDMMDLTEEL
VRNAALAVDGLVVNYQGIELDFSKPFRRVSMLNLVKEYTGIDFKTIKTDEEARKIANEKG
VELKGSESRFAVLNEVFEAYVEDKLVQPTFVIGHPTEISPLAKRDPEDPDYTHRFELFIC
GSEVANAYSELNDPLDQRERFLDQLRKKEAGDEEAHVFDEDFINAIECGLPPTGGLGIGI
DRLVMFLTDSRSIRDVILFPAMRPKA
Download sequence
Identical sequences D5EG11
gi|294102359|ref|YP_003554217.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]