SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EGB1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGB1
Domain Number 1 Region: 100-377
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.35e-68
Family RecA protein-like (ATPase-domain) 0.0000000579
Further Details:      
 
Domain Number 2 Region: 62-134
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.56e-22
Family Cold shock DNA-binding domain-like 0.00028
Further Details:      
 
Domain Number 3 Region: 12-56
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000000863
Family Rho termination factor, N-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EGB1
Sequence length 425
Comment (tr|D5EGB1|D5EGB1_AMICL) ATP-dependent helicase Rho {ECO:0000256|HAMAP-Rule:MF_01884} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1476 OC=Aminobacterium.
Sequence
MTETKTVPKPRYNFAKLSSQLITELRKIAKDIGVTGFSNLRKDDLIISILTTQAEQLNYR
FGGGTLEILNEGYGFLRPKGLLPSDHDIYVSASQIRRFGLRNGDVIWGMVRPPKDQEHYE
ALLRVEMVNFADPEAARKRPHFGTLTPIFPDSRLTLETDPDEISTRLIDLFAPIGKGQRA
LLVSPPKAGKTTVLKKIANAVTVNHPDIILMVLLIDERPEEVTDMARSVDGEIIASTFDR
PAEEHLRVANLALEKAKRLVETGKDVVLLLDSITRLARASNLVVPPSGRTLSGGMDPAAL
YFPKRFFGAARNIEEGGSLTVIGTALVDTGSRMDDVIYEEFKGTGNMELHLSRKLAEQRI
FPAVDITKSGTRREELLMGEEDLGRIWLLRRRMVNVDEAGALSLIIDKLKKSPTNRDFLL
TIKMA
Download sequence
Identical sequences D5EGB1
gi|294102459|ref|YP_003554317.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]