SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EGF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGF2
Domain Number 1 Region: 11-461
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.03e-81
Family Extended AAA-ATPase domain 0.00000000199
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5EGF2
Sequence length 468
Comment (tr|D5EGF2|D5EGF2_AMICL) Unfoldase HslU {ECO:0000256|HAMAP-Rule:MF_00249} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1517 OC=Aminobacterium.
Sequence
MIILADDKQDLTPRMIVECLDRYIVGQEKAKRAVAIALRNRMRRRNLPRDLANEVAPKNI
LMVGPTGVGKTEIARRLADLVLAPFVKVEATKFTEVGYVGRDVDSMIRDLVETAVAMVKR
VKIEEVQGPAEERAEWRLVDALLPRPERKTSMPDFMKIFSGKEAEETPPQEEDTIRESTR
NKVYALLKAGKLDEREVELEVAESASMGIPILGGAGMDSMGMNINEMLSGLLPKKTKKRR
MKVSDGKKLLQAEEAEKLIDMESVAREALDKAQEEGIIFIDEIDKVVARGTSSGPDVSRE
GVQRDLLPIVEGSTVQTKYGTVKTDHILFIAAGAFSSVKPSDLVPELQGRFPIRVELQPL
GREELARILVEPENSLIKQYQALLSTERIEVRFSEDAIEEIAAMAEKMNAEMENIGARRL
HTMVEQLLEEISFTAPERQGEVVDINAQFVKERLSPLMEDTDLRKYLL
Download sequence
Identical sequences D5EGF2
gi|294102500|ref|YP_003554358.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]