SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EGN9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGN9
Domain Number 1 Region: 75-254
Classification Level Classification E-value
Superfamily GAF domain-like 3.6e-45
Family IclR ligand-binding domain-like 0.0000641
Further Details:      
 
Domain Number 2 Region: 11-84
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000000105
Family Transcriptional regulator IclR, N-terminal domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EGN9
Sequence length 256
Comment (tr|D5EGN9|D5EGN9_AMICL) Transcriptional regulator, IclR family {ECO:0000313|EMBL:ADE57721.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1605 OC=Aminobacterium.
Sequence
MPAKKSAPSFKSLHRALAILSSFSFSRPRLSASDIASYTDIPKSTVHRFLRIFVEQGFLE
ETESPGLFAPGLKLFELGNIVHQNLDVRLSAKSPMDCLAKAYNTTVHLVIRDRDEGVYVE
KVEPVGQHVHYSNIGKRIPLYCTAAGKILLSDLTDEAIFSLLPSRLPSLTPHTIVEREVL
LNEIHKVQEKGWAEDNQELELGLCCVAVPIKDHQGHIAAAMSTSGLAASFGPERKSELIK
GLQGASMEVSRQLGFP
Download sequence
Identical sequences D5EGN9
gi|294102587|ref|YP_003554445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]