SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EGS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGS8
Domain Number 1 Region: 18-186,349-795,837-867
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-95
Family Tandem AAA-ATPase domain 0.00057
Further Details:      
 
Domain Number 2 Region: 929-1108
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 0.0000000214
Family Exodeoxyribonuclease V beta chain (RecB), C-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5EGS8
Sequence length 1173
Comment (tr|D5EGS8|D5EGS8_AMICL) Exodeoxyribonuclease V {ECO:0000313|EMBL:ADE57760.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1644 OC=Aminobacterium.
Sequence
MKMTKMNSAFTQLLKERTQPGQFKAITADAPLVAVSAGAGTGKTWTLAWRFIWILVTGRA
DTNEILTLTFTEKAALEMAERIKNLLLQLAMELPSQKVFFQKAADRIDEGYISTIHSFSM
RVLKECGLATELDPESGTIAPPQESLFWKEAEEALDRWDGNWFAKSSSHLWAQRIAKLFS
DPLFMDSVNTFGPNATVELAKSSLALFASQGQTPKDLWQWGSDLFSRDQDAVDTARLTLF
RRWEDEWHRFLQPESGIFYNLNELGGTGKLCGNVRNLITRWQQQPSKENLPHFIQSLIEG
LKGASGKLANEIAFHLKEPVSQYRNRLIKEEPWITVFTQGFDEKEQAYRSCLLGFSAILW
QLWDEFRRRKNRLSFDDMIRYAMEALEHSPSYAERFKEILVDEFQDTNPLQDRLIQAVRS
HSQRLFIVGDLKQSIYRFRHADLSLFGSYIKKAKYGHGDYILLDTSFRSKEILVHEVNDL
FSSVWKDGLGQELPLPFESLEVPHYLSTHELRQQCTVDPFLTYLEGGKEGEKIREARLRQ
IRRLALLFSQYYEEKRTVWDKQKECLRPVQWKDMAILVPSRTSWFPLLEKIFFEEFQLPI
YFEGSTSYFSRSEIQDLIALLNFLDDPGKELYLMSFLSSPLSSLSLEEVRDLALDAPKGY
RLQAFQEKWPHLARQIDDWRLMAHFLGPSAVLASFLEKSDSFLRAFPAWKRRGVAANMRK
AIDMAREFEEAIGTSLPGCASYLREAMERQEKFAEPDVSNEKENVIRVMTVHGSKGLEFP
VLAVLGLERTSSAGEKGSLMPSPKMGVALSRIPGERNSGQAPLAWSLSRLFEEQEEYEEW
QRLFYVACTRARDSLILCGHLPWRRDGYSPGDRSWLKMLLSWNPELLPLTDEPAAKAGGP
KEERERSHKYSSVPLPSSEHQYLARISATSFALFQYCPYAYRMKHRQGHELVWEQPGEYP
SEGGADVGSLVHYLLSQWDFASKPLESFFPEEENWDTFTETLPGKLRAVWKRPRVPSHIY
SWLLTFQQGAIVGRILKNNLTVKKEVPFRADLVNGPTMVGAIDLLWHENDMLFIRDFKIT
TISQVPENLYRDQLAFYALAMKKTLSVPRISLGFWHLREGTEELLSSLEREDWDQIEGEV
RKMARQALSGPFKPVKGRCSFCPFKGECTWLHA
Download sequence
Identical sequences D5EGS8
gi|294102626|ref|YP_003554484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]