SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5EGU3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5EGU3
Domain Number 1 Region: 9-257
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-68
Family ABC transporter ATPase domain-like 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5EGU3
Sequence length 333
Comment (tr|D5EGU3|D5EGU3_AMICL) Oligopeptide/dipeptide ABC transporter, ATPase subunit {ECO:0000313|EMBL:ADE57775.1} KW=Complete proteome; Reference proteome OX=572547 OS=Aminobacterium colombiense (strain DSM 12261 / ALA-1). GN=Amico_1659 OC=Aminobacterium.
Sequence
MGDKNNIPLLDIRNLSVRFNTDSGIVHAVNNLNLSLRRGKALGFVGETGAGKTTTALAVL
QLIQSPPGEITNGEIFFDGQDVMKMTEAEKRDIRGSKIAMIFQDPMTSLNPIMTVEEQIM
EMISLHSDFKGEAVRKRAHEMLALVGIRPERGKEYPHQFSGGMRQRVGIAIALACEPTLL
IADEPTTALDVTIQAQVLDLIKNLQKIVNTSLLLITHDLGIVAEICDEVAIMYAGRLVEY
SDIRQLYSKPMHPYTQGLFNAVPKLDSEPGGKLAVISGLMPDPTDLPKGCRFSPRCPYAQ
DICHEKACGMKEYEPNHFVDCFFPLGMNGGTRQ
Download sequence
Identical sequences D5EGU3
gi|294102641|ref|YP_003554499.1| WP_013049037.1.58668

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]