SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5GEI0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5GEI0
Domain Number 1 Region: 3-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.66e-76
Family Calponin-homology domain, CH-domain 0.0000448
Further Details:      
 
Domain Number 2 Region: 246-368
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-23
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 3 Region: 470-617
Classification Level Classification E-value
Superfamily EF-hand 1.92e-16
Family Calmodulin-like 0.0037
Further Details:      
 
Domain Number 4 Region: 370-475
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000009
Family Spectrin repeat 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5GEI0
Sequence length 629
Comment (tr|D5GEI0|D5GEI0_TUBMM) Uncharacterized protein {ECO:0000313|EMBL:CAZ82923.1} KW=Complete proteome; Reference proteome OX=656061 OS=Tuber melanosporum (strain Mel28) (Perigord black truffle). GN=GSTUM_00006491001 OC=Pezizales; Tuberaceae; Tuber.
Sequence
MAQQQWITTQDKTFRKWLNTKLSARNIPPAQSLQKDLATGVLLIHLLEILGNESLGKYAS
NPRLRVQKCENVHKALEYIRGRGIQLFNIGAEDIVDGNLKLILGLLWTLILRFTIADINA
EGLTAKEGLLLWCKRKTACYEEIDITDFSTSWNNGLAFCALLDFHRPDLIDYDALDKSDH
KGNTALAFKIATEEIGIPALLDVEDVCDVAKPDERSLVTYIAYWFHAFSQLERIETAGRR
VEKFVEVMQGAWEMQHGYEKRMAELLRQMHEMKQQWSTATFVGTYFDAKQQSQKFSSYKR
TLKRAWVAEKADLVSLLGNIKTKLSTYRLKDYEPPAHLSLANLDLEWKKLLQDENKRSIV
INEKIRDIKEGLRRSFADAANEFALCLNTVSLQISELDGDPEHQLRIVRTLHRNIIPLEL
ELNRIEKLSDDCEEANIEENDYTVYSYDELEYEYGLAKESVAKKLSFLDNQIVARSMTNL
TPIQLEEFESVFRHFDRDLSNSLQEIEFSAALASLGLVYDEEEMHEVFKEVSARGRSVTF
EQFIRFMVEVTEDQNSAEQVYQSFKEVADGKPYVTEFDLRHSLVPDGMIEELVSTMPKVR
AEDGEVGFDYEKYMEGLMGKKLDTNGVHH
Download sequence
Identical sequences D5GEI0
XP_002838732.1.11696 CAZ82923 GSTUMT00006491001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]