SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H791 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H791
Domain Number 1 Region: 84-253
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.64e-40
Family N-acetyl transferase, NAT 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5H791
Sequence length 261
Comment (tr|D5H791|D5H791_SALRM) Hypothetical acetyltransferase {ECO:0000313|EMBL:CBH23896.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_00975 OC=Rhodothermaceae; Salinibacter.
Sequence
MRLEPSPSWFRNGPHSLATPGRLVKACGPHAPAATTLRRSTGPVQPDGLPIRHGRDGARP
FCARFLSALSVCGTHPLMNERHLDDGFRLSGVERRDKAAVVEHLQEKEIWENTLDIPWPY
TEDDDAAWIEGRIQHRSEQPKETTFALRRADGRLVGVVGADDLDVGASHRARIGYWLAKP
YWGQGLMTKAVTRYAEYAVTELDVVRLTAEVFAWNEASARVLQKAGFTQEGRLRKHREKD
GALVDVRYFGLLRADLDGARD
Download sequence
Identical sequences D5H791
WP_013061390.1.91540 gi|294506790|ref|YP_003570848.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]