SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H7C2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H7C2
Domain Number 1 Region: 20-213
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.03e-73
Family LFTR-like 0.00002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5H7C2
Sequence length 245
Comment (tr|D5H7C2|D5H7C2_SALRM) Phenyalanyltransferase {ECO:0000256|HAMAP-Rule:MF_00688} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01006 OC=Rhodothermaceae; Salinibacter.
Sequence
MSTRTRRLSPLAPLLLPPSMPDDLTPDLLIRAYANGVFPMGDDDTGIVRWHAPDPRAHLP
LDAFHIPHNLRRRVRRREFSVTADRAFASVIEACADRARTWITPRIIRVYTELHERGYAH
SVECWQEGDLAGGLYGVGLKGAFFGESMFYRVSNASKVALVHLVRQLRAGGFTLLDTQYS
TEHLERFGVTTVPRPAFEQKLIRALDVSPDWWPLADAEAADLDTPVSEFSAAAPTPRGNE
SPPNG
Download sequence
Identical sequences D5H7C2
gi|294506821|ref|YP_003570879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]