SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H7E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H7E7
Domain Number 1 Region: 196-568
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.96e-76
Family Amylase, catalytic domain 0.0056
Further Details:      
 
Weak hits

Sequence:  D5H7E7
Domain Number - Region: 573-650
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00171
Family alpha-Amylases, C-terminal beta-sheet domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5H7E7
Sequence length 678
Comment (tr|D5H7E7|D5H7E7_SALRM) (1->4)-alpha-D-glucan:maltose-1-phosphate alpha-D-maltosyltransferase {ECO:0000256|HAMAP-Rule:MF_02124} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01031 OC=Rhodothermaceae; Salinibacter.
Sequence
MASSATSPPASPDPTMPKSWSRVVISSVAPAIDGGQWPIKRAVGEQVEVTAGVLVDSHDA
LAVELVVRHASEETEHVTRMPHVENDEYAGAFEVSAPGRYLYRVRAWINRFATWQDQFRR
RVEGGEPPSEIESELTAGASLLDEAAEHAPEDDREMLTAHIEAFENGNAEAALGDEIAEL
ARRHAPHHQQTSSATYEVLVDPERARTGAWYEFFPRSARDDDEHATLDEAAERLPRIQEM
GFDIVYLPPIHPIGETNRKGPDDAPEAGPDDPGSPWAIGGFLADGSKGGHKSVHPKLGGI
EAFDRFVETAHDLGLEVALDVAFQCSPDHPYVEEHPEWFYHRPDGSLRYAENPPKKYKDV
HPINFETEAWPALWTELKSVFEYWIDHGVTTFRVDNPHTKPFAFWQWCLRELREDTPELV
VLSEAFTRPKTMHHLAKLGFNNSYTYFTWRNTPDALEAYGEELFHTEAAEYFRPNFWPNT
PDILHDELVDGGRPAHKSRFVLAATMSSTYGVYGPPFEHVDTQQRDHKEEYARNEKYEIR
TWDWNDPTSLQPFMARVNRLRNENPALQQTRSIRFLDTQHPDLIAYSKAAGDNLIVVVVS
LDPHSECEGQLVLPIHDLGLPADEAFSAHDLLHDAHYTWQGTHHYLRLSPDRPAHIFRLE
PAGTSEQTHAAYDRLVHA
Download sequence
Identical sequences D5H7E7
gi|294506846|ref|YP_003570904.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]