SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H7G8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H7G8
Domain Number 1 Region: 3-287
Classification Level Classification E-value
Superfamily "Helical backbone" metal receptor 1.1e-46
Family TroA-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5H7G8
Sequence length 314
Comment (tr|D5H7G8|D5H7G8_SALRM) Periplasmic binding protein {ECO:0000313|EMBL:CBH23973.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01052 OC=Rhodothermaceae; Salinibacter.
Sequence
MPRVVSLIPSATEIVAALGHRDALVGRSHECDHPPGVEALPALTAPKVPLEGSSWEIDDR
VRALLDEAMSVYDVDVERLNALRPDLILTQSQCEVCAVSLPTVEQAVADRIEGSPTVVAL
EPRSLADVRDDIRRVAGALGCPDRGDRLVRRMRDRMQATSNAVAPADATDRPTVAALEWI
DPLMGAGGWVPTLLEAAGGTPVFARRRGDLDALHEADPDRIVVMACGFGLSRTDAEMDVL
RNDNRWAALRAVQAGHVYRADGNHFFNRPGPRLAASLDILAEILHPDRFHAAIDRSHRDT
AWRREPAPAPSATR
Download sequence
Identical sequences D5H7G8
gi|294506867|ref|YP_003570925.1| WP_013061463.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]