SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H8Q2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H8Q2
Domain Number 1 Region: 142-376
Classification Level Classification E-value
Superfamily Duplicated hybrid motif 1.15e-57
Family Peptidoglycan hydrolase LytM 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5H8Q2
Sequence length 436
Comment (tr|D5H8Q2|D5H8Q2_SALRM) Peptidase M23B {ECO:0000313|EMBL:CBH24407.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01486 OC=Rhodothermaceae; Salinibacter.
Sequence
MSFSRGPVRLLAVLLIVAGGGIACQTGATAPTAPTESTAVFEVSTDRYGLPTGRYEVEDG
RVGRAETFSDVLGEHGVDYQTILRLADAARPEFEVTNLRAGRPYRVYVNPWLQQPQYLAY
QIDARRYVVFDLQHPDRTHVATRPVTRQWATVAGTVEGSLYETVVDNGGHPLLALRLSEV
FAWQIDFFRLRAGDSFRLVYEARAVEGDAVQPGDIVAAHVRHRGEDYYAFRFESGAGDAE
YFNRAGQSLRRQLLKAPLQYSRISSGYTNRRYHPVLKEYRPHRGVDYAAPRGTSVRSVGE
GVVQRAGYEGPNGNYVKIRHNGTYTSGYLHLSQISVASGDRVQQGETIGYVGSTGRSTGP
HLDYRLWKHGSPVNPVTLELPPSQPVPLQHRDAFRATVRALLPRLDGESVFARVSSPPGP
RWNDRTAPAGSHIANR
Download sequence
Identical sequences D5H8Q2
WP_013061818.1.91540 gi|294507301|ref|YP_003571359.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]