SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H8T4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H8T4
Domain Number 1 Region: 77-231
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 3.9e-45
Family Deoxycytidylate deaminase-like 0.0000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5H8T4
Sequence length 237
Comment (tr|D5H8T4|D5H8T4_SALRM) Probable cytidine deaminase {ECO:0000313|EMBL:CBH24439.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01518 OC=Rhodothermaceae; Salinibacter.
Sequence
MRHGPWQERRFECVDGPVKKVLPGAACKRRLGQAHERPRAPRRPGTKRRDSRMMEAIWAG
APVPLPGSRFRFLSIESDPPMPSPSSFLREAIEMAVQNVTTGQGGPFAALVVRDGEIVGR
GTNVVTTLNDPTAHAEVTAIRRACDALDDFELAGCTLYATCEPCPMCLGAAYWARLDRVY
YAATQEDAAEAGFDDHHIYEEMAKPPTERQIPMDQALSEEANRPFEAWLDYEDRVAY
Download sequence
Identical sequences D5H8T4
WP_013061845.1.91540 gi|294507332|ref|YP_003571390.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]