SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H9I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H9I9
Domain Number 1 Region: 78-240
Classification Level Classification E-value
Superfamily Peptide methionine sulfoxide reductase 2.62e-66
Family Peptide methionine sulfoxide reductase 0.0000242
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5H9I9
Sequence length 259
Comment (tr|D5H9I9|D5H9I9_SALRM) Peptide-methionine (S)-S-oxide reductase {ECO:0000256|HAMAP-Rule:MF_01401} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01773 OC=Rhodothermaceae; Salinibacter.
Sequence
MGNGRNWEKVCCPAKAEDVFPFTRPVPCVMTPSTQSYWLLGAALLAAVLAGGMFFQGPSS
DGNAPSPAPTDSVPAAMADTATFAGGCFWCMEPPYDKIDGVASTTSGFAGGEEVDPSYRE
VASGATRHTEVVQVVYDSTTVSYERLLRVYWHNVDPFDGTGQFCDRGSQYRPAIFAHDAQ
QQRSAERSKVTVAAQFDRDIAVQVQSLDAFYAAEQYHQNYYQKNPADYKRYRQGCGRDAR
LREIWGEAALSDAPLDGTT
Download sequence
Identical sequences D5H9I9
gi|294507588|ref|YP_003571646.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]