SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5H9N6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5H9N6
Domain Number 1 Region: 103-302
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.95e-58
Family BC ATP-binding domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 4-99
Classification Level Classification E-value
Superfamily PreATP-grasp domain 5.47e-17
Family BC N-terminal domain-like 0.011
Further Details:      
 
Domain Number 3 Region: 309-378
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 4.79e-16
Family BC C-terminal domain-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5H9N6
Sequence length 379
Comment (tr|D5H9N6|D5H9N6_SALRM) 5-(carboxyamino)imidazole ribonucleotide synthetase {ECO:0000256|HAMAP-Rule:MF_01928, ECO:0000256|RuleBase:RU361200} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_01820 OC=Rhodothermaceae; Salinibacter.
Sequence
MSSTFPTIGILGGGQLGKMMAAEAVRMSVDARLLSPKEAGPMQPYTGARVGDWTDPDVLR
PFTADCDVVTVESEWAPADAAAEVLPDGAALWPSTQTLSLIKDKGVQKQHLADAGCPVPT
FACCETLDEALDAAEEFGYPVVLKQYRGAYDGYGNATAASEDELREAWPDLATEDGAMVE
TFADFARELAVQVARRPGGNQVVYPVAYTEQRDHRCHAVEVPADIDDAIADKARHIAQKS
VDAVEGVGLIAVELFEMPDGRVLVNELAPRPHNTGHYSIEGAATSQFENHVRAVLDWPLG
DPSLRTPVAVMVNVLGRREGTPPQTTGLPRALDTEGVTPHIYGKPDVRPGRKMGHVTALG
ADRADTRKRAEMAASAIEL
Download sequence
Identical sequences D5H9N6
WP_013062098.1.91540 gi|294507635|ref|YP_003571693.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]