SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5HBP4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5HBP4
Domain Number 1 Region: 171-395
Classification Level Classification E-value
Superfamily Dihydrofolate reductase-like 1.21e-52
Family RibD C-terminal domain-like 0.00056
Further Details:      
 
Domain Number 2 Region: 25-172
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 1.07e-40
Family Deoxycytidylate deaminase-like 0.0000373
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5HBP4
Sequence length 397
Comment (tr|D5HBP4|D5HBP4_SALRM) HTP reductase {ECO:0000256|PIRNR:PIRNR006769} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_02528 OC=Rhodothermaceae; Salinibacter.
Sequence
MTADGLAAPDLRHGNVPPVDDTGHVPWMKRCLDLARTGAGTVSPNPMVGAVLLAPDGTVL
GEGAHRTYGGPHAEARALQAAEQQHSPAALQNATLYVNLEPCRHHGKTPPCTDLIVEKNV
PRVVVGTVDPFPQAQGRGIRQLREQGVEVEVGVHEHACRRLNEAFFHHVDTGRPLVTLKT
AQTLDGRIATRTGDSQWITGEAARTLVHQWRAELDGILVGRGTAAHDDPRLTVRHVDGPQ
PLRLVLDRKGTLSPDRTLFTDAHADDTVAVVGDDRPRPDYAGPLTNRGGAILRVPETDDA
HLDLHALLQRLGTDAGRDAEPLQSLLVEAGPGLATALFRQDLVDRFFCFVAPKVLGDGRP
ALHDLGITEMDGALTFAEQAWATVGADVLLRGYRRTV
Download sequence
Identical sequences D5HBP4
gi|294508343|ref|YP_003572401.1| WP_013062519.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]