SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5HBR0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5HBR0
Domain Number 1 Region: 7-157
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 3.77e-34
Family N-acetyl transferase, NAT 0.0000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5HBR0
Sequence length 169
Comment (tr|D5HBR0|D5HBR0_SALRM) Spermidine N(1)-acetyltransferase {ECO:0000313|EMBL:CBH25465.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_02544 OC=Rhodothermaceae; Salinibacter.
Sequence
MESSPRVSIRKATPDDAKTLVDLIVELATYENLLDEAEPSVELLEEHLSAEALTGCEALL
AETERDTAVGFALFFHNYSTFQTNAGLYVEDLFVRSTYRGEGIGLALFRRLAEIAEKRGC
RRIDWAVLDWNTEAIEFYDELGAEPLDDWTTMRLDEEAIEEIATAGAAA
Download sequence
Identical sequences D5HBR0
WP_013062531.1.91540 gi|294508359|ref|YP_003572417.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]