SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5HCR8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  D5HCR8
Domain Number - Region: 217-278
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0089
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.018
Further Details:      
 
Domain Number - Region: 148-210
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0379
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5HCR8
Sequence length 380
Comment (tr|D5HCR8|D5HCR8_SALRM) Uncharacterized protein {ECO:0000313|EMBL:CBH25823.1} KW=Complete proteome OX=761659 OS=Salinibacter ruber (strain M8). GN=SRM_02902 OC=Rhodothermaceae; Salinibacter.
Sequence
MVADCVPPWRASAAPSPPVSGLALDLLPLMLFLVVVSRTSGALTASFSSSASGNCRGALV
LLCRHAEQGLRPVVPGPCRPLPPVSLATASQAMRLPPPLRALLNWFRTLLRNTYFWGGLG
GLLLLGVGAYFLVDAVLMPTYTRHGVSVQVPNVESQSFLEAKKRIEARDLQVKREVGRFN
PNVPRETVVDQNPPPNSGVKPGRRVYLTVNAGEAPVVNIPDLNGISVREAKNRVSSLGLA
VGTVEPDSLPSPYPNTITRQRPEPGDSLKTGGTVDLWYSTGLGTDTVQVPNIAGRAVERA
RRLLRARQLRAIVLDPRTADPSDAPSQPSDTSSSRRFVQRQGRAPTTKVRAGTEIRLFTT
DDSTAVPKPDSIAQDTTAPS
Download sequence
Identical sequences D5HCR8
gi|294508716|ref|YP_003572775.1| WP_013062838.1.91540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]