SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5MI88 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5MI88
Domain Number 1 Region: 6-328
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.62e-58
Family Nitrous oxide reductase, N-terminal domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5MI88
Sequence length 333
Comment (tr|D5MI88|D5MI88_9BACT) Uncharacterized protein {ECO:0000313|EMBL:CBE67238.1} KW=Complete proteome; Reference proteome OX=671143 OS=Candidatus Methylomirabilis oxyfera. GN=DAMO_0122 OC=Bacteria; candidate division NC10; Candidatus Methylomirabilis.
Sequence
MCRRSRLFRLASAALLFGVGTTASVRAEYAYITNQGDDSVSVVNIEKGEVIATIAVADAP
VGVATTPDGTHLYITHPEAGLISEIDTVTRTVVKTIDTGGQPFGIAVDDTAPVAGNNAQT
RRLLFVTDWSRNAVMTVDPVRGVVIDLIHAGKSPAGIALDRRARRVFVANRESNTLTVLD
ADVPRRYADIPTGRAPFAVALVPNGERVYVGNVQSGELTVIDAKALDVVATVKVGRFPYG
IAVTPDGARVVVANQQDHNITIVDALSLRTVGNIRVGRHPDGVDITGDGSHALIANWFDD
SISIIDLSTLKERTRVKAGKGCRAFGSFIVRNR
Download sequence
Identical sequences D5MI88
gi|392373250|ref|YP_003205083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]