SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5TZP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5TZP7
Domain Number 1 Region: 36-313
Classification Level Classification E-value
Superfamily SIS domain 5.68e-34
Family double-SIS domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5TZP7
Sequence length 328
Comment (tr|D5TZP7|D5TZP7_THEAM) Uncharacterized protein {ECO:0000313|EMBL:ADG90347.1} KW=Complete proteome; Reference proteome OX=633148 OS=Thermosphaera aggregans (strain DSM 11486 / M11TL). GN=Tagg_0065 OC=Desulfurococcaceae; Thermosphaera.
Sequence
MEEMYLEWSRQARIALEKPVSVRFNRGFRSIIVAGMGGSGIVGDVLSTLSAKYSSLPVIT
VKNHILPGYTSPEDLLLVVSYSGNTIETLRIFDSALERNIPMVTVSSGGLLKTRAYEHGI
PHVKLPEGLAPRASLPSMLYGILKLLYENNLLNIPFKIIEDSVVFLEEKAGKAVADAGVI
AEWVNRCKGLLVISTHSPLESLGLRGKNEFNENAKIPVKVDVAPEWMHNDIVGYEEPFLK
DFTVLEVVDPDDKVGVMLVDFMRTIYAKVTGRFHRLVLEGVSLLDKIMYGSMVFGLSSCK
LARMRGIDPLKTASILEYKKVAGTIFSS
Download sequence
Identical sequences D5TZP7
gi|296241812|ref|YP_003649299.1| WP_013128940.1.1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]