SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U0E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U0E3
Domain Number 1 Region: 4-180
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.5e-35
Family GHMP Kinase, N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 166-306
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.97e-33
Family Mevalonate kinase 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U0E3
Sequence length 307
Comment (tr|D5U0E3|D5U0E3_THEAM) Mevalonate kinase {ECO:0000256|HAMAP-Rule:MF_00217} KW=Complete proteome; Reference proteome OX=633148 OS=Thermosphaera aggregans (strain DSM 11486 / M11TL). GN=Tagg_0317 OC=Desulfurococcaceae; Thermosphaera.
Sequence
MTCSKAPGKIVLFGEHFVVKGAPAIGFAVSKYAKVCVEDGSLNIISKQTGRVEQDSLLYR
AVKRLITKVNSIFECSEDVKILIDSEIPIGSGMGSSAALSVALAHAYLTHCNVDFDKKLV
NEIAYEAEKEVHSKPSGIDNTLATFGGFLKYRSGVFEKLEVRLGEEVYFLVVNTNLRRQT
GKIVEEVLKLYEKYPEILENVYNAASALVEKALKSLEERDYESIGRLMLLNHGLLWTIGV
SHEVNDLIVHKLVAKGCLGAKLSGAGKGGIVIGLVKESLVDKIEGELRNEGFEVFRVTPD
YEGVRNV
Download sequence
Identical sequences D5U0E3
gi|296242058|ref|YP_003649545.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]