SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U4Y9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U4Y9
Domain Number 1 Region: 209-504
Classification Level Classification E-value
Superfamily TPR-like 9.2e-60
Family Tetratricopeptide repeat (TPR) 0.00098
Further Details:      
 
Domain Number 2 Region: 448-610
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.43e-43
Family Protein prenylyltransferase 0.014
Further Details:      
 
Domain Number 3 Region: 128-250
Classification Level Classification E-value
Superfamily TPR-like 3.41e-28
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U4Y9
Sequence length 617
Comment (tr|D5U4Y9|D5U4Y9_BRAM5) TPR repeat-containing protein {ECO:0000313|EMBL:ADG72393.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_2320 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MTRISNYLFNKHIEKCKISLKGFEKSEVQDLKDDFKKEAEKILADANNFLNGIDALNYSD
FDTFNSKAETFNDELNTILETFYIKDPDEIYTYNRFIEYFHYDNTMFNDENDKIDVNDLH
ILDEYFDYNTNGVVDNNTGSYEKAIEYYNKAIDLIPNYALAYYNRGLARNNLGFFKKAIK
DYDKAIELSKNYKDAYYNRGLAKNNANLHKEAIEDYSKVIELDHKNIDAYNNRGVSKNYL
HLFDEAIKDFNKILELDPNNYYAYGNRGNSKHDLGLYKEAIKDYDKAIKINPNYADCYYN
RANSKKELGLFKEAIKDYDNAIKWKPKDINVYINRGNAKYDLELYEEAIKDYDKIIKLDS
NYTDAYYNRANAKRELGLYNEAIKDYDKAIYLNPNYSEAYNNRGLAKSGLGMYKEAIKDY
EESIDLCADNPEAYYNIGSAKYDLGLLKESIKYYDKAIELRPTYSEAYNNRGLSKNDLEL
YKEAIKDYDKSIELNPNDSNTYNNRGLTKSSLGLYKEAIKDYSKAIELSPNYVYAYSNRG
SAKDELGEYKEAIKDYDKAIELKPNMAYLYNDRGWVKKNAGLYKEALKDYKKALELEPNN
EYAIENMKSLKKEYGLK
Download sequence
Identical sequences D5U4Y9
WP_013114732.1.81496 gi|296127340|ref|YP_003634592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]