SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U4Z0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U4Z0
Domain Number 1 Region: 230-494
Classification Level Classification E-value
Superfamily TPR-like 2.2e-55
Family Tetratricopeptide repeat (TPR) 0.0025
Further Details:      
 
Domain Number 2 Region: 12-327
Classification Level Classification E-value
Superfamily TPR-like 8.25e-49
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 3 Region: 499-667
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 3.14e-39
Family Protein prenylyltransferase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U4Z0
Sequence length 750
Comment (tr|D5U4Z0|D5U4Z0_BRAM5) TPR repeat-containing protein {ECO:0000313|EMBL:ADG72394.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_2321 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MNNSNNSIEELLNKAKESFENKDYEKAIEYIDKVIFYNGDSYDLYHNRGLAKLNLRLYEG
AIKDFDRAIELGDYNSYYERGLAKFYMAFYKEAIEDFNKVVELDKSSAASFAYNTIGLCK
YNLNEFDEALKYYNKAIETNPNLIIAYHNIALLKHSMGLDDEALSYLNKALEIDTNNIET
YLKIYSIKLGLGLEREANEYLDKIMEMYPDDLYIYDRIGNIKIDAGYMEESLEYLKKALE
INPNFIDAYYDIAFALHKLNLNDEALSYLEKALQISPNNADTYFKIFLIKRALGDYDGAL
SCLEKILEIDDTDVAIYNEIALIKIELELYEEALYYLNKALCIDNNNAEIYNTIGLVYHY
KRNYEEAIKNFNKALELNTSMDMAYYNIGLSYYEMHDYEKAIEYYNKALEINTQYSAAYI
NLGLIEHNFGNYQEAINYYKRALEINPNYSLSYYNIALAEMSLEDYDKALEDFNHALELG
YNEADIYTNIGLIYSREAIYDKAIEYYNKVLEINPNKVNAYYNIAFCLSNMDKYKEALEI
YDKVIRMYPGNFDVYYERGYTKYRVSKYEEAIRDFDIIINVNSKHYNAYYYRGCSKKYLK
NYDEAIKDFDKAIEYNPNNPDYYSEKASCYDYLNKYRESIENYDKAIELNDNDWFLYILR
AKEKFLLSKETNLENKTNDKKSFFNKIISKITSSKNYTDLEKSALNDLEKSYNLALEDEF
NLMVFKDIIKDEFTNIDLAADFCKDNNITL
Download sequence
Identical sequences D5U4Z0
gi|296127341|ref|YP_003634593.1| WP_013114733.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]