SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U539 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U539
Domain Number 1 Region: 1-109
Classification Level Classification E-value
Superfamily SpoIIaa-like 6.47e-25
Family Anti-sigma factor antagonist SpoIIaa 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5U539
Sequence length 110
Comment (tr|D5U539|D5U539_BRAM5) Anti-sigma factor antagonist {ECO:0000256|RuleBase:RU003749} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_0199 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MSLNIDDKGKVKVVSLAGKLDVNLSVSIEAELEQLVESGSHFLILELSGIEYLSSSGIRV
FISIMRKIKDKNGRLVLACVPDIIKKILKTVELEDLFEVYDTVDDAVASF
Download sequence
Identical sequences D5U539
WP_013112735.1.81496 gi|296125253|ref|YP_003632505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]