SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U5F2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U5F2
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily YjgF-like 4.4e-45
Family YjgF/L-PSP 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5U5F2
Sequence length 127
Comment (tr|D5U5F2|D5U5F2_BRAM5) Endoribonuclease L-PSP {ECO:0000313|EMBL:ADG72429.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_2357 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MDKKIIKTHKAPQAIGPYSQAVKSGNFIFASGQIPLDPVSGNMAENDIKKQTERVMENIK
GLLESENLTMANIIKTTCFLTDMANFASFNEVYAAYFPENPPARSTVAIKSLPKDALVEV
EIIAAIS
Download sequence
Identical sequences D5U5F2
gi|296127376|ref|YP_003634628.1| WP_013114767.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]