SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U648 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U648
Domain Number 1 Region: 20-98
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 0.0000578
Family FabZ-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U648
Sequence length 114
Comment (tr|D5U648|D5U648_BRAM5) Beta-hydroxyacyl-(Acyl-carrier-protein) dehydratase, FabA/FabZ {ECO:0000313|EMBL:ADG70539.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_0436 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MDNYIGFKDYNIEEKTSDMFRVKVFIDERMPYFDGHFENLKLLPAIAQVKIALDIYKSIF
SRNFSVNKLLKLKFVNMIFPNTIITLECYYLNNTLSFKMYDEDKKYSDGKIYLK
Download sequence
Identical sequences D5U648
gi|296125486|ref|YP_003632738.1| WP_013112966.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]