SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U6I9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U6I9
Domain Number 1 Region: 23-309
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 6.78e-79
Family EF1021-like 0.0000000838
Further Details:      
 
Domain Number 2 Region: 311-426
Classification Level Classification E-value
Superfamily SCP-like 4.32e-26
Family EF1021 C-terminal domain-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5U6I9
Sequence length 426
Comment (tr|D5U6I9|D5U6I9_BRAM5) Eis, predicted acetyltransferase-like acetyltransferase {ECO:0000313|EMBL:ADG70555.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_0452 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MSIHNKKEYSKENIIRKKKNKFIIRYLTLEDLEMFNNLLRYAFQVSNNELITLGYEIDEI
KQAKSAVLSKAKVLGWFDGEKLASQIAVYPMKMNIHGVIYKMAGVTGVATYPEYSNLGLM
NDLMIKSIEIMKKEGQTISVLYPYSIPFYRRKGWEIISDKMSFEIKDTQLPKTITNSGRV
ERVSSDSNDLKELYDKFSHMRHGALIRGDLEWEEYWRWDVDDTIVAIYYDEKDEANGFLV
YVIENDIFHVKEMVYLNFEARLGLWNYISAHFSMVDKVNGYNYTNEPMAFLLEDSEIKET
IRPYIMARITDVKAFIINYPFLRKPKNKKINLIIKDNMAKWNNGSFLIHWDEERNTICKR
LSKEYKRNSKDRYIIKMNIQTLTAMLMSYKSPSYLYKIERIESSIKGINLLESIIPKEQV
YFSDYF
Download sequence
Identical sequences D5U6I9
gi|296125502|ref|YP_003632754.1| WP_013112982.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]