SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U7S1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U7S1
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.82e-28
Family Putative Holliday junction resolvase RuvX 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5U7S1
Sequence length 141
Comment (tr|D5U7S1|D5U7S1_BRAM5) Putative pre-16S rRNA nuclease {ECO:0000256|HAMAP-Rule:MF_00651, ECO:0000256|SAAS:SAAS00701333} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_2800 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MVLGVDFGRKKTGTAFMDMNIKIPFPLLLIEESNAKKVKRALMDIIEEKNIDTVVFGLPL
SDEGKESEWCSEIRRFSDFLLKSVKVNVVFVDEYGTSKEADYILRGRKKNVKKKANDLIA
AALILENYLNVLNMNNKNDNV
Download sequence
Identical sequences D5U7S1
WP_013115203.1.81496 gi|296127814|ref|YP_003635066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]