SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U8E5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U8E5
Domain Number 1 Region: 8-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.000000155
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5U8E5
Sequence length 114
Comment (tr|D5U8E5|D5U8E5_BRAM5) Uncharacterized protein {ECO:0000313|EMBL:ADG70968.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_0869 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MIKEYCIKNNKNIILIIEKDINKKMYNELYCILNRILENGSKNIIIYFRNSIKYIISNAI
YLMLETQKVLEFRGGKMILTGLNEYAKWSVKSLEAHKKIKIFDNIQNAIKEITA
Download sequence
Identical sequences D5U8E5
WP_013113394.1.81496 gi|296125915|ref|YP_003633167.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]