SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5U8J0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5U8J0
Domain Number 1 Region: 7-359
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.28e-50
Family Amylase, catalytic domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5U8J0
Sequence length 476
Comment (tr|D5U8J0|D5U8J0_BRAM5) Alpha amylase catalytic region {ECO:0000313|EMBL:ADG71013.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_0916 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MRVSGYNLFPPLLGHIKNWYSHVDRIKAMGFEWIYINPITYPGFSGSLYAAKYYYQYNPS
FFTSSNQNIAEKELKDFILYCRSKQIKVMIDLVINHSSKDCNLTQEHIEWYKTKDGSLQS
PGAWDNGKWIEWGDLAIFNNKRDPNEKDEEEKEDINKDNSNENNPEATNNEILNPIWYYW
NDLIKHNLDLGFEGFRCDAAYKVPKELWKYLIDNAKEHNKDVIFFAESLGCSIEDTEKLI
DAGFDYVASSAKWWDYEGEWFVEQYDLVRKKCRQIAFPSNHDTKRLITEYDGNIWRVKQT
FLFTAIVCDMWMITTGDEYGFINRCNVVGGSEKDYENISYDLSEYIKNIINYVKQNSILA
DCGEIVSLDIEEKKKLEKLKKEYEYHEHHEYYEDNSKEENNKKDPFRKFYKYSLDGKDKV
LIVVNITSKERLLDANKYGIKYDISFDNVVSNITDTVKVLPYELKIFRLREDTYWA
Download sequence
Identical sequences D5U8J0
gi|296125960|ref|YP_003633212.1| WP_013113439.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]