SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5UA93 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5UA93
Domain Number 1 Region: 186-382
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 9.15e-16
Family Protein prenylyltransferase 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5UA93
Sequence length 394
Comment (tr|D5UA93|D5UA93_BRAM5) Uncharacterized protein {ECO:0000313|EMBL:ADG71616.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_1529 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MKEKTLKKFNFAILILFPIILLIFSVTFNIYSVGTKNRINKELENFTNSLSLRMESKYMD
MMTLYFKDELNNYAIANEFTNLVKEQVRLGVTPHFNSLKFSIDYTIRTNIRNTTYGLLFI
SVLMFILTLVLNFTNNSFVSSSSNMNVSPAADNSSNKTSDKPQAKPINNVIDSSSSENIK
AEIEAMYKNLVKEIKSSRDEQALEILEKMFQLDDRNYLALNGAGVLHTKIYSRDNEEEHF
KKADKYFEYALSLYNNNENVYNNKAILYSIKYELKKLEDDYETALIIFNDALSSNHLDPE
LLNNRATLYSVKYKISGDENLFERALNDYDELIKMDFNNIYALNNRSAIYFNKYKNSGDK
KYFDKSIEDCNTAFKINSSEALYDNRGSLYIYKF
Download sequence
Identical sequences D5UA93
WP_013114033.1.81496 gi|296126563|ref|YP_003633815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]