SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5UAK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5UAK6
Domain Number 1 Region: 89-256
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.62e-28
Family DnaQ-like 3'-5' exonuclease 0.02
Further Details:      
 
Weak hits

Sequence:  D5UAK6
Domain Number - Region: 19-72
Classification Level Classification E-value
Superfamily 5' to 3' exonuclease, C-terminal subdomain 0.0345
Family 5' to 3' exonuclease, C-terminal subdomain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5UAK6
Sequence length 287
Comment (tr|D5UAK6|D5UAK6_BRAM5) Exonuclease {ECO:0000313|EMBL:ADG71729.1} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_1643 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MDLLKRTFQHIEGIGPKKESLLWEEGAIDWEDTLKNIDYYAMPKSIREALKDELPRSIYN
YKNKNYHYFLKRFPTPIIYRLYPFFMDKIVFLDIETTGIKPSKADVTVIGCYDGKEMKVF
VHGRNENEFLDYIKNYSIVCTFNGSCFDIPFLERYFATTIKCAQIDLRFVLKDLGYTGGL
KKIEQDVGLSRGDDMEGVTGYTAVLLWNYYQDTKDETAIDSLIHYNLLDTINLEYLLCLA
YNKYAESYNSSLLEYKPLPPITNYKPNKKLIDALHKKPYKYAPKSED
Download sequence
Identical sequences D5UAK6
gi|296126676|ref|YP_003633928.1| WP_013114144.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]