SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for D5UBF9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5UBF9
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.45e-24
Family Ribosomal L11/L12e N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 67-140
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.26e-20
Family Ribosomal protein L11, C-terminal domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5UBF9
Sequence length 140
Comment (tr|D5UBF9|D5UBF9_BRAM5) 50S ribosomal protein L11 {ECO:0000256|HAMAP-Rule:MF_00736} KW=Complete proteome OX=526224 OS=(Serpulina murdochii). GN=Bmur_1954 OC=Bacteria; Spirochaetes; Brachyspirales; Brachyspiraceae; Brachyspira.
Sequence
MAKRVVGIVKVRIPGGEATPAPPLGPALGQKQIQIAAFVKDFNAKTSKMKGQILNTYITV
YEDKTYTFVTKGTSTSTLIKKKLGIEKGSGEPNKTKVAAINQKQLEEIAQEKMAYMSAND
IEAAKKIVAGTARAMGIKVE
Download sequence
Identical sequences D5UBF9
gi|296126979|ref|YP_003634231.1| WP_013114405.1.81496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]