SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5V1L5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5V1L5
Domain Number 1 Region: 507-980
Classification Level Classification E-value
Superfamily ALDH-like 4.45e-101
Family ALDH-like 0.000000758
Further Details:      
 
Domain Number 2 Region: 135-455
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 5.1e-71
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) D5V1L5
Sequence length 1188
Comment (tr|D5V1L5|D5V1L5_ARCNC) L-glutamate gamma-semialdehyde dehydrogenase {ECO:0000256|PIRNR:PIRNR000197} KW=Complete proteome; Reference proteome OX=572480 OS=NCTC 12251 / CI) (Campylobacter nitrofigilis). GN=Arnit_1795 OC=Campylobacteraceae; Arcobacter.
Sequence
MKNETKIINSAVELAEKWQNRATELVSDFDREFYVKMNKMLDHPKDKALLIELMDQCFRC
DSNARVADQIIFLLEKHGMAHFFTTKDKTLLWLFQNFGKFLPNLSVPMFVNQIREDTKTV
VIKGEEEPFNKHLIMRKEEGTRVNINLIGEVVLGEEEAGERMEKYLKALSNPNIDYISIK
ISTIYSQINPLNFENTVQVLVEKLTKIYEQAIKYPYIAPDGTKSNKFINLDMEEYRDLAI
TVEVFKRTLDKPQFKDFYAGIVLQAYIPDSFLVQKDLLAWAKKRVENGGSPIKFRLVKGA
NMEMEETEASQKHWEMVTYTDKSDTDSNYKRMARHALQPENAPFMHIGTASHNLFELAFA
TTLAQENGTTKYHTLEMLEGMSEAARLAIREISKSVILYAPTAAKEQFTNAIAYLVRRLD
ENTGPDNFIRYSFGLTVGSKDWNMQKELFLKSFENEKTSFVGSKRTQNRLTEKWNDFSHT
SYDTKEYHAEADTDFILSANQEWAKNIVKKWKFSKDTEHKITPIVVGGEDIVEGRTVVEA
IDKCQIEDGVLAGKFANANAEDLKRAVEVAKADVDGWRSLTHEQRHAALKNVSNKLKERR
ADLIGVAAAEVGKVFTETDVEVSEAVDFVEFYPYSAHHFDKYENIEFTGKGVGVVVPPWN
FPVAIPLGGVAATLAAGNTVIIKPASVAALTAYEMCKCFWDAGISKNVLQFVPCPGALAG
EHLIANKDVDFVILTGGEDTAATMLKTRPDLQLSAETGGKDATIVTNMADREQAIKNVCL
SAFNNSGQKCSATSLLVLEEEVYNDESFKKALVDTARSMSVGSIWDFKNRIGTLANPVSG
NLKKAIETLEGNEEWLLAPSYAEGNEYMLKPAIKWGVEEGSFIHMNELFGPVLAVIKAKD
LAHAVKIVNDTGYGLTSGIESLDEREVSYWKANLKAGNLYVNRGTTGAIVLRQPFGGMGK
SAIGAGRKVGIFNYITQFVNFTEKSNPIVSKKYNSDLVKFIDSCKSKGENKEDFEKLSVA
VQSYYENYENEFSKAKDYCEVRGEDNHFRYLPLDKVVIRVSSDDTIFEVVSRILAARISN
VNFTVSINSNAAIKDFLTKSTVLLGTNNVIEEDDKAFANTIKDYQRVIYSDISKVPASIF
EATSRSLTYIVRQAPMMEGRLELLNYFIEQSISHSFHRYGNIGARGLK
Download sequence
Identical sequences D5V1L5
gi|296273325|ref|YP_003655956.1| WP_013135594.1.41079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]