SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5WRL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5WRL2
Domain Number 1 Region: 9-235
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.43e-61
Family PP-loop ATPase 0.00032
Further Details:      
 
Domain Number 2 Region: 395-476
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.46e-21
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.01
Further Details:      
 
Domain Number 3 Region: 215-322
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000000000000392
Family MesJ substrate recognition domain-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5WRL2
Sequence length 497
Comment (tr|D5WRL2|D5WRL2_KYRT2) tRNA(Ile)-lysidine synthetase {ECO:0000256|HAMAP-Rule:MF_01161} KW=Complete proteome; Reference proteome OX=562970 OS=tusciae). GN=Btus_0095 OC=Kyrpidia.
Sequence
MIDKLIDWFDRHRELPPLHRVVLAVSGGVDSMVAMDLIGQLSGALGFSVVVCHVDHRMRP
ESGDEQRFVEAEAVRRGLAFQGVAVDVPGRIRKTGESPQAAARALRYEALTQCAREAGAE
AVILAHHQDDQAETVLLRLLRGTSPAGLGGMNEVRRWGDLWWLRPFLKVPKAELVAYATD
HGIPYREDPSNWSTKYLRNKIRLQLIPLLEREYQPQIKNHLARLAQMIQEDEAVLTPMAL
EARDRCVRGGSGNYRIDIPRFSDLPAALQRRVLTLILDYPSERLPGWGAIQVEALRNLAL
HGRSGSELRLSGGWRARRVYDELVLDRFGEAGRIGVGPVGVPPMPLLVPGRTSCPILGVT
IDATVVSRQEWELRARAEAANDPGVGPSTPAVADFDWERMEGRPLFIRSRLPGDRFAPFG
LGGTKKIKDVWIDDKVPRELRDRWPLLAAGREILWIIGWRRSDRWPVAKDTRRILHVEAT
WTDEEIREWAHRRTRKN
Download sequence
Identical sequences D5WRL2
gi|295694779|ref|YP_003588017.1| WP_013074167.1.77002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]