SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5WWA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5WWA6
Domain Number 1 Region: 23-325
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 4.97e-60
Family DmpA-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) D5WWA6
Sequence length 330
Comment (tr|D5WWA6|D5WWA6_KYRT2) Peptidase S58 DmpA {ECO:0000313|EMBL:ADG07671.1} KW=Complete proteome; Reference proteome OX=562970 OS=tusciae). GN=Btus_3051 OC=Kyrpidia.
Sequence
MRENGDGPGTTSDGVQRAAWFPLPGVRIGHAHDLRARTGCTVVLTPEGAAAGVDVRGSAP
GTRETDLLDPVNLVQEVHGVLLAGGSAFGLAAADGVMRYLEERGYGLDVGVGRVPIVPGA
VLFDLAVGDGSRRPDAVMGYAACEAAREVPERGRVGAGAGATVGKALGHLRAMDGGLGTA
AVQLPGGLVVAAVVAVNAVGHVVDPATGEILAGPLGEDGKPLDTLAVWNTGPGFGVLLPG
TNTTIGVVVTNARMSKVQAKKVATMAHDGLARVIRPAHTMYDGDALFALAVGGVTAPVDL
VGAWAAETVAAAVLDGVRQSASNGGAGRGD
Download sequence
Identical sequences D5WWA6
gi|295697577|ref|YP_003590815.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]