SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for D5XA98 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  D5XA98
Domain Number 1 Region: 83-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.48e-35
Family Ribosomal protein L6 0.0000245
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.2e-29
Family Ribosomal protein L6 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) D5XA98
Sequence length 181
Comment (tr|D5XA98|D5XA98_THEPJ) 50S ribosomal protein L6 {ECO:0000256|HAMAP-Rule:MF_01365, ECO:0000256|RuleBase:RU003870} KW=Complete proteome; Reference proteome OX=635013 OS=Thermincola potens (strain JR). GN=TherJR_0311 OC=Thermincola.
Sequence
MSRIGKQPVIIPQGVEVKVDGNVVTVKGPKGQLVKEFHKDMLITVEDNKIVVQRPSDEKV
HRSLHGLTRTLVSNMVDGVTKGFQKELELSGVGYRAAKQGNKLVLTVGYSHPVEMEPQNG
IEIEVPAANRIVVKGIDKETVGAFAAKIRSVREPEPYKGKGIKYVDERIRRKVGKTGGKK
K
Download sequence
Identical sequences D5XA98
WP_013119222.1.83787 gi|296131851|ref|YP_003639098.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]